Protein Info for PFLU_RS22840 in Pseudomonas fluorescens SBW25

Annotation: 3-hydroxyacyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 11 to 203 (193 residues), 116.1 bits, E=3.6e-37
• PF16113: ECH_2
  • amino acids 16 to 191 (176 residues), 65.3 bits, E=1.4e-21
• PF02737: 3HCDH_N
  • amino acids 318 to 496 (179 residues), 200.9 bits, E=3.4e-63
• PF00725: 3HCDH
  • amino acids 499 to 599 (101 residues), 53.8 bits, E=4.6e-18

Best Hits

KEGG orthology group: K01782, 3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC: 1.1.1.35 4.2.1.17 5.1.2.3] (inferred from 100% identity to pfs:PFLU4661)

Predicted SEED Role

"Enoyl-CoA hydratase [isoleucine degradation] (EC 4.2.1.17) / 3-hydroxyacyl-CoA dehydrogenase (EC 1.1.1.35) / 3-hydroxybutyryl-CoA epimerase (EC 5.1.2.3)" in subsystem Acetyl-CoA fermentation to Butyrate or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation or Isobutyryl-CoA to Propionyl-CoA Module (EC 1.1.1.35, EC 4.2.1.17, EC 5.1.2.3)

MetaCyc Pathways

• oleate β-oxidation (33/35 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (12/14 steps found)
• fatty acid salvage (6/6 steps found)
• adipate degradation (5/5 steps found)
• fatty acid β-oxidation I (generic) (6/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• (R)- and (S)-3-hydroxybutanoate biosynthesis (engineered) (4/5 steps found)
• 4-hydroxybenzoate biosynthesis III (plants) (4/5 steps found)
• adipate biosynthesis (4/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (4/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (19/26 steps found)
• L-valine degradation I (6/8 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (5/7 steps found)
• L-isoleucine degradation I (4/6 steps found)
• methyl ketone biosynthesis (engineered) (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• valproate β-oxidation (6/9 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (6/10 steps found)
• 6-gingerol analog biosynthesis (engineered) (3/6 steps found)
• propanoate fermentation to 2-methylbutanoate (3/6 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (5/9 steps found)
• glycerol degradation to butanol (10/16 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (2/5 steps found)
• pyruvate fermentation to butanol I (4/8 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• superpathway of phenylethylamine degradation (6/11 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• pyruvate fermentation to butanoate (3/7 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)
• phenylacetate degradation I (aerobic) (4/9 steps found)
• methyl tert-butyl ether degradation (4/10 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• 2-methylpropene degradation (2/8 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
• L-tryptophan degradation III (eukaryotic) (6/15 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (8/18 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (7/17 steps found)
• L-glutamate degradation VII (to butanoate) (3/12 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (3/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (3/14 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (4/17 steps found)
• toluene degradation VI (anaerobic) (4/18 steps found)
• cholesterol degradation to androstenedione I (cholesterol oxidase) (2/17 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• androstenedione degradation I (aerobic) (6/25 steps found)
• platensimycin biosynthesis (6/26 steps found)
• cholesterol degradation to androstenedione II (cholesterol dehydrogenase) (3/22 steps found)
• superpathway of testosterone and androsterone degradation (7/28 steps found)
• androstenedione degradation II (anaerobic) (4/27 steps found)
• superpathway of cholesterol degradation I (cholesterol oxidase) (8/42 steps found)
• superpathway of cholesterol degradation II (cholesterol dehydrogenase) (9/47 steps found)
• superpathway of cholesterol degradation III (oxidase) (5/49 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Bile acid biosynthesis
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.35, 4.2.1.17, 5.1.2.3

Use Curated BLAST to search for 1.1.1.35 or 4.2.1.17 or 5.1.2.3

Sequence Analysis Tools

See C3K0T7 at UniProt or InterPro

Protein Sequence (715 amino acids)

>PFLU_RS22840 3-hydroxyacyl-CoA dehydrogenase (Pseudomonas fluorescens SBW25)
MTQAIRYEKGQDGIVVLTLDMPGQSANTMNSVYREAMAATIERLEAEKDGLAGVVITSAK
KTFFAGGDLNELIKVDTAHATAFYDSVLVLKAQLRRLETLGKPVVAAINGAALGGGWEIC
LACHYRVALDDKSVQLGLPEVTLGLLPGGGGVVRMVRSLGLEKALPYLLEGKKVRPQQAL
QAGLVNELAADREALLAKSRAWILANPDAKQPWDNKAYQIPGGTPSSPKVAQMLAIAPSI
LRSKTQGCFPAPEKILCAAVEGAQVDFDTAHLIETRYFTELVTGQVAKNMIGTFWFQLNE
INAGRSRPQGFAPYVTRKVGVLGAGMMGAGIAYVSASAGIDVVLKDVNLAAAEKGKAHSV
ALLDKKVSRGQLTAQQREATLARIHPTASDADLAGCDLIIEAVFEDRELKAKVSAAAQSV
VGAEAVIASNTSTLPISGLATAVPDQAKFIGLHFFSPVDKMPLVEIIKGTHTSDETLARG
FDFVLQIKKTPIVVNDSRGFFTSRVFGTFTNEGIAMLGEGVAAPMIETEARKAGMPVGPL
AVSDEVSLSLMSHIRQQTSKDLQAEGKAVPTHPATAVIDLLVNEYKRVGKAAGGGFYEYP
SGGQKYLWPELKSRFERPDQRISPQDVRDRLLFIQAIETVRCVEEGVLMSTADANVGSIF
GIGFAAWSGGALQFINQYGLNDFVARARYLAEQYGERFAPPTLLLDKAARGEVFR