Protein Info for PFLU_RS22750 in Pseudomonas fluorescens SBW25

Annotation: Asp/Glu/hydantoin racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 PF01177: Asp_Glu_race" amino acids 3 to 208 (206 residues), 161.1 bits, see alignment E=1.7e-51

Best Hits

Swiss-Prot: 38% identical to HYDRA_PAEAU: Hydantoin racemase (hyuA) from Paenarthrobacter aurescens

KEGG orthology group: K01797, [EC: 5.1.99.-] (inferred from 100% identity to pfs:PFLU4644)

MetaCyc: 42% identical to allantoin racemase monomer (Klebsiella pneumoniae)

Predicted SEED Role

"Hydantoin racemase (EC 5.1.99.-)" in subsystem Hydantoin metabolism (EC 5.1.99.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K143 at UniProt or InterPro

Protein Sequence (242 amino acids)

>PFLU_RS22750 Asp/Glu/hydantoin racemase (Pseudomonas fluorescens SBW25)
MRILVVNVNTTDSITETIAQQARAVAAPGTEIVGLTPYFGAESVEGNFESYLAAIAVMDR
VMAYDQPFDAVIQAGYGEHGREGLQELLNVPVVDITEAAASTAMFLGHAYSVVTTLDRTV
PLIEDRLRLAGLYQRCASVRASGMAVLALEQDPLAAMEAIVRQAELAISEDKAEVICLGC
GGMAGLDEQIRQRTGVPVVDGVTAAVTIAESLVRLGLSTSKIRTYATPRAKKVVGWPGKF
GR