Protein Info for PFLU_RS22425 in Pseudomonas fluorescens SBW25

Annotation: YbaB/EbfC family nucleoid-associated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 3 to 108 (106 residues), 105.6 bits, see alignment E=6.9e-35 PF02575: YbaB_DNA_bd" amino acids 10 to 102 (93 residues), 112.9 bits, see alignment E=3.2e-37

Best Hits

Swiss-Prot: 100% identical to Y4577_PSEFS: Nucleoid-associated protein PFLU_4577 (PFLU_4577) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K09747, hypothetical protein (inferred from 100% identity to pfs:PFLU4577)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K0S7 at UniProt or InterPro

Protein Sequence (112 amino acids)

>PFLU_RS22425 YbaB/EbfC family nucleoid-associated protein (Pseudomonas fluorescens SBW25)
MMKGGMAGLMKQAQQMQEKMAKMQEELANAEVTGKAGGDMVSVVMTGRHDIKRVSIDPSV
LPGVGEDDLEMLEALFAAAVNDAVRKIEANSQEKMGGVTAGMQLPPGMKLPF