Protein Info for PFLU_RS22135 in Pseudomonas fluorescens SBW25

Annotation: sodium:solute symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 43 to 66 (24 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 118 to 141 (24 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 180 to 199 (20 residues), see Phobius details amino acids 218 to 238 (21 residues), see Phobius details amino acids 258 to 283 (26 residues), see Phobius details amino acids 308 to 332 (25 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 378 to 397 (20 residues), see Phobius details amino acids 404 to 424 (21 residues), see Phobius details amino acids 431 to 449 (19 residues), see Phobius details PF00474: SSF" amino acids 32 to 412 (381 residues), 127.2 bits, see alignment E=3.9e-41

Best Hits

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 100% identity to pfs:PFLU4513)

Predicted SEED Role

"sodium-solute symporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYF5 at UniProt or InterPro

Protein Sequence (460 amino acids)

>PFLU_RS22135 sodium:solute symporter (Pseudomonas fluorescens SBW25)
MALDLFVVLIYAAGMLVLGYYGMRRAKTHEDYLVAGRNLGPSLYMGTMAATVLGGASTVG
TVRLGYVHGISGFWLCAALGMGIIALNLFLAKPLLKLKIFTVTQVLEKRYNPMARQASAV
IMLAYALMIGVTSILAIGTVLQVLFGLPFWISVLLGGGVVVVYSTIGGMWSLTLTDIVQF
VIKTVGLMFILLPICLYRVGGWDELVAKLPASSFSFTAIGWDTIITYFMIYFFGILIGQD
IWQRVFTARDEKVAKYAGTFAGFYCILYGLACALIGMAAHVLIPDLDNVNNAFAAIVKVS
LPDGIRGLVIAAALAAMMSTASAGLLAASTVLTEDLLPRLRGGKQSSLAVNRLFTMLTGI
AVLGIALVVSDVISALTLAYNLLVGGMLIPLIGAIFWKRATTSGAITSMTLGFVTALVFM
LKDGLDANTPIYYSLAIGLVSFVLVSVLSRRPEGVATRAV