Protein Info for PFLU_RS21925 in Pseudomonas fluorescens SBW25

Annotation: YecA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 TIGR02292: yecA family protein" amino acids 6 to 180 (175 residues), 161.8 bits, see alignment E=6.3e-52 PF03695: UPF0149" amino acids 9 to 181 (173 residues), 120.8 bits, see alignment E=4e-39

Best Hits

KEGG orthology group: K07039, uncharacterized protein (inferred from 100% identity to pfs:PFLU4469)

Predicted SEED Role

"FIG00953416: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K0X5 at UniProt or InterPro

Protein Sequence (195 amino acids)

>PFLU_RS21925 YecA family protein (Pseudomonas fluorescens SBW25)
MSFAEQLTRLQAFLDADELHDEALDYVAAHGYLTALSICSEVVPDREWIDALFAEEPHYA
DAAQREEIESTLLALKAHIGRQLASDEEFELPCELDLGEEPDDSDLRGWCIGFMEGVFLR
EAAWFETAEEEVSEMLLPIMVGSGLFDDQPEFSDIAADANLMDDMIVQIPEALTALYLLC
NAPDEKPAILKPRHH