Protein Info for PFLU_RS21840 in Pseudomonas fluorescens SBW25

Annotation: flagellar assembly peptidoglycan hydrolase FlgJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF10135: Rod-binding" amino acids 57 to 108 (52 residues), 61 bits, see alignment 1.3e-20 TIGR02541: flagellar rod assembly protein/muramidase FlgJ" amino acids 208 to 408 (201 residues), 204.2 bits, see alignment E=2e-64 PF01832: Glucosaminidase" amino acids 271 to 409 (139 residues), 123.2 bits, see alignment E=1e-39

Best Hits

KEGG orthology group: K02395, flagellar protein FlgJ (inferred from 100% identity to pfs:PFLU4452)

Predicted SEED Role

"Flagellar protein FlgJ [peptidoglycan hydrolase] (EC 3.2.1.-)" in subsystem Flagellum (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K0V8 at UniProt or InterPro

Protein Sequence (423 amino acids)

>PFLU_RS21840 flagellar assembly peptidoglycan hydrolase FlgJ (Pseudomonas fluorescens SBW25)
MAMDMRKSGISSTADSGSYSDLNRLNQLKVGDDKNSEGNMRKVAQEFESLFLSEMLKSMR
SATEALGKDNPLNTPAAKQYQEMYDQQLAVSMSREGGGIGLADVLMRQMQKNKPVEAQAA
TLQGPAAAESAKKVAVPTEIAAGTQAEGPLGRSNGQRPLWAYRVAEPQAGAAASHSNDME
LMNQRRIALPSKLTDRLLAGIVPNAPVAIDAKSAPLRNSAADDNVVNSTARTFAVPSGRM
QVYGRAVAQPPLAPAKKAFSSQDEFVATMLPMAKAAAARIGIDPKYLVAQAALETGWGKS
VMRAEDGSSSHNLFGIKAGQSWQGGQARAITSEFRDGAMVKETAQFRSYNSYQDSFHDLV
TLLQSNDRYKEVVKSADNPEQFVRELQKAGYATDPAYASKISQIAKTMNSYQNYAAAGAT
THL