Protein Info for PFLU_RS21730 in Pseudomonas fluorescens SBW25

Annotation: flagellar basal body-associated protein FliL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details PF03748: FliL" amino acids 67 to 166 (100 residues), 79.6 bits, see alignment E=1.1e-26

Best Hits

KEGG orthology group: K02415, flagellar FliL protein (inferred from 100% identity to pfs:PFLU4429)

Predicted SEED Role

"Flagellar biosynthesis protein FliL" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K0J2 at UniProt or InterPro

Protein Sequence (166 amino acids)

>PFLU_RS21730 flagellar basal body-associated protein FliL (Pseudomonas fluorescens SBW25)
MAKSDDAAKAPAGKGKLKLILLIVLGLLLAIGASVGGTWYIMHSSASKPAPAAETASNVK
QPAIFEPMLPAFVANFNQNGRQRYLQVSITLLARNQSDLDALKVHMPVIRNNLVMLFSGQ
SFDTLATPVGQEMLRQKVTASVQEVAQKELGKVVIEQALFTNFVLQ