Protein Info for PFLU_RS21545 in Pseudomonas fluorescens SBW25

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 232 to 247 (16 residues), see Phobius details PF00106: adh_short" amino acids 15 to 201 (187 residues), 155.5 bits, see alignment E=2.5e-49 PF08659: KR" amino acids 16 to 128 (113 residues), 52.9 bits, see alignment E=8.9e-18 PF01370: Epimerase" amino acids 17 to 85 (69 residues), 22.6 bits, see alignment E=1.3e-08 PF13561: adh_short_C2" amino acids 24 to 253 (230 residues), 179.7 bits, see alignment E=1.5e-56

Best Hits

KEGG orthology group: K13774, citronellol/citronellal dehydrogenase (inferred from 100% identity to pfs:PFLU4393)

Predicted SEED Role

"Citronellol and citronellal dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K0F7 at UniProt or InterPro

Protein Sequence (290 amino acids)

>PFLU_RS21545 SDR family oxidoreductase (Pseudomonas fluorescens SBW25)
MAFDSIFKADLFQGQTVMVTGGGSGIGRCTAHELAALGAQVILVGRKPEKLQAVAAEIAE
DGGIAHWHACDIRDEEAVKALVSQVLNDHGQLHGLVNNAGGQYPSPLASINQKGFETVLR
TNLVGGFLVAREVFNQSMSKHGGAIVNMLADMWGGMPGMGHSGAARAGMDNFTKTAAFEW
GYAGVRVNAVAPGWIASSGMDTYEGAFKAVIPTLREHVPLKRIGTESEVSAAIVFLLSPA
AAFISGSTLRIDGAASLGSRAWPLHKAQAPSEPFNGFHRAYLPDVLKAEQ