Protein Info for PFLU_RS21085 in Pseudomonas fluorescens SBW25

Annotation: cation:dicarboxylase symporter family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 152 to 172 (21 residues), see Phobius details amino acids 194 to 219 (26 residues), see Phobius details amino acids 229 to 255 (27 residues), see Phobius details amino acids 266 to 283 (18 residues), see Phobius details amino acids 302 to 328 (27 residues), see Phobius details amino acids 336 to 381 (46 residues), see Phobius details PF00375: SDF" amino acids 8 to 406 (399 residues), 382.6 bits, see alignment E=1.1e-118

Best Hits

Swiss-Prot: 55% identical to GLTP_ECOLI: Proton/glutamate-aspartate symporter (gltP) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4294)

MetaCyc: 55% identical to glutamate/aspartate : H+ symporter GltP (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-122A; TRANS-RXN-162

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K046 at UniProt or InterPro

Protein Sequence (431 amino acids)

>PFLU_RS21085 cation:dicarboxylase symporter family transporter (Pseudomonas fluorescens SBW25)
MHTPRIALVWQIMIGLLAGIALGALLHRFPESRPWLVDNLLQPAGDIFIKLMKMIVVPIV
FSCMVVGIAGHGDGKSLGRIGARSLGYFFCITTLAIIVGLVLGNLLKPGAGTELSSLHAA
TITLPTSNGGGHSLGQIIVGIIPDNVINAMAQGSLLSVLFFAVMFGLGVARLPAERKDPV
IALLRGVSDAMFKVTSMIMAYSPIGVFGMIAVTVANFGFGSLMPLAKLIMVSYVAIAFFV
LVVLNLVARLCGINLFALMRHIKDELVLAFSTASSAAVMPQLMKKLETYGVPPSLVSFVV
PVGYSFNLDGASLFLGIGTLFVAQLYGIDLSFGDQALLVVTMVLTSKGAAGVPGFMFVIL
SATLASAGLPLEGIAFIAGVYRLMEMPTTALNVLGNALAPLVIAKWESREARAAQQQTAQ
TLPDCGVQNKP