Protein Info for PFLU_RS20990 in Pseudomonas fluorescens SBW25

Annotation: zinc-binding dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR02824: putative NAD(P)H quinone oxidoreductase, PIG3 family" amino acids 18 to 341 (324 residues), 412 bits, see alignment E=7.9e-128 PF08240: ADH_N" amino acids 45 to 120 (76 residues), 44.7 bits, see alignment E=1.6e-15 PF00107: ADH_zinc_N" amino acids 167 to 282 (116 residues), 88.7 bits, see alignment E=4.7e-29 PF13602: ADH_zinc_N_2" amino acids 199 to 339 (141 residues), 79.4 bits, see alignment E=7.7e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4273)

Predicted SEED Role

"Quinone oxidoreductase (EC 1.6.5.5)" in subsystem ZZ gjo need homes (EC 1.6.5.5)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.5

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K027 at UniProt or InterPro

Protein Sequence (343 amino acids)

>PFLU_RS20990 zinc-binding dehydrogenase (Pseudomonas fluorescens SBW25)
MVDGDRCDRRGTGRLDRMKAVIACEPGGPEVLQVVERPVPELHAGEVLIRVTAAGVNRPD
LMQRNGSPIPSGVTDVLGLEAAGIVVVVGTGVDEFAIGDRVMALLSGGGYAEYCVAQAAH
CLPVPAGLSLHDAAGVPEAAFAVWHNLFELGRLRSGDTALIHGAASGVGSFAVQCAHAAG
ARVIATAGGPQKVAMLQALGVWRAVDRHAEDFVDAVNDCTEGRGVDVVLDNVGGPYVARN
LAAMAMGGRHVSLSFLQGARIELDLQVLMRKNLSLTSSTLRPKSHAEKARLAVCIRSRLL
PWLASGLVRPQVHAQLPLAQAADAHRLLEANANIGKVVLTVAE