Protein Info for PFLU_RS20440 in Pseudomonas fluorescens SBW25

Annotation: heavy metal sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 169 to 190 (22 residues), see Phobius details TIGR01386: heavy metal sensor kinase" amino acids 7 to 462 (456 residues), 419 bits, see alignment E=1.4e-129 PF00672: HAMP" amino acids 188 to 240 (53 residues), 34.2 bits, see alignment 4e-12 PF00512: HisKA" amino acids 246 to 309 (64 residues), 45.8 bits, see alignment E=7.9e-16 PF02518: HATPase_c" amino acids 356 to 464 (109 residues), 78.9 bits, see alignment E=5.9e-26

Best Hits

KEGG orthology group: K07644, two-component system, OmpR family, heavy metal sensor histidine kinase CusS [EC: 2.7.13.3] (inferred from 100% identity to pfs:PFLU4172)

Predicted SEED Role

"Heavy metal sensor histidine kinase" in subsystem Cobalt-zinc-cadmium resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZR1 at UniProt or InterPro

Protein Sequence (468 amino acids)

>PFLU_RS20440 heavy metal sensor histidine kinase (Pseudomonas fluorescens SBW25)
MNKRRHYSLTLRLALIFALLAFALLATLGVALYRELERELIMRDDAALINRIDQLRNLLN
DSNTLDLIKTKPELFQNMLGNRESVLRIVAPGQKPLLTVNPGNIELPSVPPVPKNHALTF
ADVHHFPSINGVPFATVAASIDSGDLGSLQVTTGRLMTERTAVLASYRLSVYILASMAAI
ILAVVGYLLVHRGLLPLRRLARHAQGIGVGNLAERLDSHGAPKELLPMIDSFNTMLERLA
KGFVQLGQVSTDMAHELRTPINNLLGETQVALQQSRSIESYQQLLASNVEELERLARMLD
NMLFLARTDPASALRQRQELSAADEVERIADYFEGLAGDVQISIHAEGEGVIWAEPMLLR
RALANLCANAIKYGAPCTELVIQAVPNAEGIHLRVSNRGETIAAEHLPRLFERFYRVDES
RERSAQSNGLGLSIVATIMQLHNGRYSVSSEAGVTCFELFFPRREDSP