Protein Info for PFLU_RS20085 in Pseudomonas fluorescens SBW25

Annotation: helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF09339: HTH_IclR" amino acids 21 to 68 (48 residues), 35 bits, see alignment 9.6e-13 PF01614: IclR" amino acids 140 to 260 (121 residues), 60.2 bits, see alignment E=1.9e-20

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4109)

Predicted SEED Role

"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZJ7 at UniProt or InterPro

Protein Sequence (273 amino acids)

>PFLU_RS20085 helix-turn-helix domain-containing protein (Pseudomonas fluorescens SBW25)
MNLLSESERPSDLDADSKGSSLERMLRVLDLFTEASPIWAVDEMGAALGYTRSTIYRYVR
ELAEASLLFQVEAGRYALGARIITWDRQLRLSDPLVRAAQSLEQALPRWSEQQVWLICRL
FKDQVVCIHQHGELFSEVSYSRGSPRPLFLGATSKAILANMTSRQHRQLFLENPDEVRAS
HLGQTWEQFRRALQQLRRQGYVASAAEIDPGVYGLAAPIFDSDGKVLGSISCVRPIEERD
NAQEAQQGEQMLALAQTLSQRMAALTHRPAQPD