Protein Info for PFLU_RS20005 in Pseudomonas fluorescens SBW25

Annotation: TonB-dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 801 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF07660: STN" amino acids 62 to 113 (52 residues), 30.4 bits, see alignment 4.1e-11 PF07715: Plug" amino acids 158 to 250 (93 residues), 63 bits, see alignment E=5.3e-21 TIGR01783: TonB-dependent siderophore receptor" amino acids 159 to 801 (643 residues), 353.3 bits, see alignment E=1.5e-109 PF00593: TonB_dep_Rec" amino acids 479 to 766 (288 residues), 132.4 bits, see alignment E=6.6e-42

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 100% identity to pfs:PFLU4093)

Predicted SEED Role

"TonB-dependent ferric achromobactin receptor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZG0 at UniProt or InterPro

Protein Sequence (801 amino acids)

>PFLU_RS20005 TonB-dependent receptor (Pseudomonas fluorescens SBW25)
MPAVRPLRLRPLLKLSLMLSLSASPLFAAVSYAEDTASRRSYQVPAGSLSAALTRFAGLS
GVNLSVDPALVSGRSSSGLSGEFGVEEGFARLLQGSGLQLQPMGEQAYMLVPAPDGSSLE
LAPTSILGTTGLYDGDTYAGGQVARRGSQGLLGTRDFMETPFSMTTYTQDAVKNQQARTL
GDLIASDPSVRATNPAGGRYEQFTIRGFSLFNSDVAYNGLYGVLPTYTIDMEMADRVDIF
KGPTQLINGISPRGSVGGGINVVPKRATDKDINSFTGNWASDSQAGGAVDIGRRFGEDNK
FGIRFNGVKQSGDTEWDHQSVDREMAVLGLDFRGERLRLSTDIGHTERDTDAPQERVQVA
AAAPVPSANDVRRNYAQSWSKASTNDTFGTVNAEYDLSDNVMLYGGVGARKSNHDFLRHA
VSVTNAAGDFVVSPRDFTRDENVRTYTAGVRNWFQTGSVSHEVNLAASYFYMDFENGGAR
YANGRSNLYNPVQTLTPSTATRQDAKVYTENKFSGVALSDTLGFFDDRLLLTLGARWQRV
KVDDWNNGVKGLTGYDEEKVSPSGGLLFKATDKLSLYANYMEGLSQGKVAPSTSNNDDEI
FPPFISRQVEVGAKYDAGAFAVTAAVFRIKQPAYETNSTTNLFGPNGKRQNTGAELSVFG
EPLKGVRLLGGVMYIDSELRKTTNGTYDGNRAPATPKYNVNLGAEWDVPTLEGLTLTSRG
LYSSSQYLDQSNDKEIDAWNRIDVGARYAFKVDDKHITLRANVENVADKRYWSSAGASDD
SEPGLTLSTPRTYLLSATVDF