Protein Info for PFLU_RS19995 in Pseudomonas fluorescens SBW25

Annotation: Fe(3+)-dicitrate ABC transporter substrate-binding protein FecB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01497: Peripla_BP_2
  • amino acids 45 to 273 (229 residues), 83.9 bits, E=5.9e-28

Best Hits

Swiss-Prot: 52% identical to FECB_ECOLI: Fe(3+) dicitrate-binding periplasmic protein (fecB) from Escherichia coli (strain K12)

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 100% identity to pfs:PFLU4091)

MetaCyc: 52% identical to ferric citrate ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-9-RXN [EC: 7.2.2.18]

Predicted SEED Role

"Iron(III) dicitrate transport system, periplasmic iron-binding protein FecB (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.18

Sequence Analysis Tools

See C3JZF9 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PFLU_RS19995 Fe(3+)-dicitrate ABC transporter substrate-binding protein FecB (Pseudomonas fluorescens SBW25)
MRLLRSIPTLAACVLAFSSSLLSAAPIDLNDGQHAVHLPDAPKRVVVLEFSFLDSLAAVD
VTPVGAADDGDANRVLPRVRQAIGQWTSVGLRSQPSIEEIARLKPDLIVADLNRHQALYN
DLSSIAPTLLLPSRGEDYEGSLKSAELIGKALGKSPQMTARIAQNRENLKNIAQQIPAGA
SVLFGVAREDSFSVHGPDSYAGSVLQAIGLKVPSVRANAAPTEFVSLEQLLALDPGWLLV
GHYRRPSIVDSWSKQPLWQVLGAVRNQHVAEVDGDSWARNRGVLASEQIAEDTLAILKGG
KAVLSQ