Protein Info for PFLU_RS19890 in Pseudomonas fluorescens SBW25

Annotation: type II secretion system secretin GspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 740 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 104 to 726 (623 residues), 460 bits, see alignment E=6.1e-142 PF21305: type_II_gspD_N0" amino acids 105 to 170 (66 residues), 34.6 bits, see alignment E=2.1e-12 PF03958: Secretin_N" amino acids 201 to 259 (59 residues), 39 bits, see alignment 1.2e-13 amino acids 266 to 331 (66 residues), 34.3 bits, see alignment E=3.4e-12 amino acids 341 to 476 (136 residues), 42 bits, see alignment E=1.3e-14 PF00263: Secretin" amino acids 550 to 716 (167 residues), 182.5 bits, see alignment E=7.9e-58

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 100% identity to pfs:PFLU4070)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZD8 at UniProt or InterPro

Protein Sequence (740 amino acids)

>PFLU_RS19890 type II secretion system secretin GspD (Pseudomonas fluorescens SBW25)
MIDTFPGALRTTVLCLATAVSLGGCGTFPEHLDPDEALLHEAMQGTGSQRPPVDPASEQA
PVDSGQPQAKTPPQRQLIRGNQQFVRAPSAAPAGKEEGAGDIVFNFADQPIEAVINSVMG
DLLHENYSIAQGVKGNVSFSTSKPVNKQQALSILETLLSWTDNAMIKQGNRYVILPANQA
VAGKLVPEMRVSQPSSGLSARLFPLRYISATEMQKLLKPFARENAFLLVDPARNVLSLAG
TPEELANYQDTIDTFDVDWLKGMSVGVFGLQRASVAELMPELQKMFGPDSGMPLAGMVRF
LPIERTNSVVAISSQPQYLSEVGDWIHTIDEGGGNEPQMYVYDVRNMKATDLAKYLRQIY
GTGAIKDDTPAKVAPGLRTATLSSPGTNSTSGSTPGGLSNTLNNNQPAAEDEEQAPDAEQ
DDAEQGATEDAPTKSLDAGTRITAQKSSNQLLVRTRPVQWKEIESAIKRLDNPPLQVQIE
TRILEVKLTGELDLGVQWYLGRLAGNSTSTTVGNTAGSQGALGGGGAGLGAADSLFYSFV
SSNLQVALHALETNGRTQVLSAPSLVVMNNQPAQIQVGDNIPISQTTVNTGTSDTTLSSV
EYVQTGVILDVVPRINPGGLVYMDIQQQVSDAQDQASSSNDTQNNPRISTRSVSTQVAVQ
SGQTVLLGGLIKQDNAESVSAVPYLGRIPGLRWLFGNTSKSKDRTELIVLITPRVITSSS
QARQVTDDYRQQMQLLKPGG