Protein Info for PFLU_RS19815 in Pseudomonas fluorescens SBW25

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details PF01494: FAD_binding_3" amino acids 10 to 42 (33 residues), 24.1 bits, see alignment 6e-09 PF01266: DAO" amino acids 11 to 359 (349 residues), 251.1 bits, see alignment E=7.3e-78 PF13450: NAD_binding_8" amino acids 14 to 54 (41 residues), 28.4 bits, see alignment 4.7e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU4054)

Predicted SEED Role

"Opine oxidase subunit B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JZC2 at UniProt or InterPro

Protein Sequence (394 amino acids)

>PFLU_RS19815 FAD-binding oxidoreductase (Pseudomonas fluorescens SBW25)
MAGNQAGSKSDVLIIGGGIMGASSAFFLRRRGCSVTLLERDQIGQYASGVNFGNVRRQGR
YLGQLELANRSWALWKRLPELIDDDLEFIPSGHMRVCYREDEIAELEAYAAAPEAAQLDL
QIYRGAELHKRFGFLGPDVKGGSYAPHDGHANPRLAAPAFARAARRLGARIEERTEVADV
EKVNGLFHVTTTDGQLFVAEQLLITAGAWAARLSERFGEPVPLEPNGPQMSVTEPVPYAL
PTVIGVFTKIKEEVIYFRQIPRGNIIIGGGNRCTPDMINRRAYFKPESLLNQMRQMRRLL
PGAEKLNIIRVWSGIESYTPDSLPVMGPSGAVDGLFYAFGFCGHGFQLGPGVGDVMAELI
STGSTSTLISPFDIRRFTQPSTVPASAPTTGKLI