Protein Info for PFLU_RS19750 in Pseudomonas fluorescens SBW25

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00890: FAD_binding_2
  • amino acids 7 to 39 (33 residues), 21.1 bits, 5.6e-08
• PF01266: DAO
  • amino acids 7 to 355 (349 residues), 237 bits, E=1.7e-73
• PF13450: NAD_binding_8
  • amino acids 10 to 48 (39 residues), 24.8 bits, 7.9e-09

Best Hits

KEGG orthology group: K00303, sarcosine oxidase, subunit beta [EC: 1.5.3.1] (inferred from 100% identity to pfs:PFLU4041)

Predicted SEED Role

"Opine oxidase subunit B"

MetaCyc Pathways

• glycine betaine degradation I (6/8 steps found)
• creatinine degradation I (2/4 steps found)
• creatinine degradation II (2/5 steps found)

KEGG Metabolic Maps

• Glycine, serine and threonine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.5.3.1

Use Curated BLAST to search for 1.5.3.1

Sequence Analysis Tools

See C3JZA9 at UniProt or InterPro

Protein Sequence (383 amino acids)

>PFLU_RS19750 FAD-binding oxidoreductase (Pseudomonas fluorescens SBW25)
MKVQKADVVIVGGGVMGSAAAFFLRRRGQSVILLERDQIGQYASGVNFGNVRRQGRFLGQ
LALANRSWALWKRLPELIDDDLEFIPSGHMRVCYREDEIAELEAYAAAPEAEQLDLKIYR
GAELHQRFGFLGPDVKGGSYAPHDGHANPRLAAPAFARAARRLGAQIEERTEVAEVQKVG
ADFHVTSTDGRQFQAAQLLITAGAWGQKLSAQFGEPVPLDTHGPQMAVTEPVPYALPTVI
GVYTKIPEEVIYFRQIPRGNIVIGGGYRSKPDMLNRRAYVEPRSILNQVSQMRRLLPGVG
NLNIIRVWSGIEGYLPDSLPVMGPSGTVDGLFYAFGFCGHGFQLGPGVGDVMAELLATGS
TSTPIEPFSIARFAPPAEQRSQA