Protein Info for PFLU_RS19525 in Pseudomonas fluorescens SBW25

Annotation: sterol desaturase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 139 to 156 (18 residues), see Phobius details PF04116: FA_hydroxylase" amino acids 57 to 211 (155 residues), 47.3 bits, see alignment E=1.4e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3997)

Predicted SEED Role

"Sterol desaturase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYZ2 at UniProt or InterPro

Protein Sequence (225 amino acids)

>PFLU_RS19525 sterol desaturase family protein (Pseudomonas fluorescens SBW25)
MSHPTETFRARYRASVAPHYNPWLHASFVFGYGIVCITLAWSSTHQITALQWLSVPATLV
FFNLCIYLVHRHLGHHKHGLARLFYARHTGDHHSFFTPGHMTYDSPRDWRVILFPAWLIV
LHSLAITLPAWWLLKQWSPNVAGLFAGCMILGYLLYEVFHACEHLPVGHPVARLPWLRQM
HRLHALHHRRELMQGRNFNIVLPLMDYLFGTLHWEPSAHDKQEPS