Protein Info for PFLU_RS19495 in Pseudomonas fluorescens SBW25

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 212 to 234 (23 residues), see Phobius details PF01370: Epimerase" amino acids 12 to 169 (158 residues), 28.1 bits, see alignment E=2.7e-10 PF08659: KR" amino acids 12 to 161 (150 residues), 44.2 bits, see alignment E=4.1e-15 PF00106: adh_short" amino acids 12 to 188 (177 residues), 140.6 bits, see alignment E=9.1e-45 PF13561: adh_short_C2" amino acids 16 to 239 (224 residues), 163.3 bits, see alignment E=1.5e-51

Best Hits

Swiss-Prot: 45% identical to DER_CHICK: D-erythrulose reductase (DER) from Gallus gallus

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3991)

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYY6 at UniProt or InterPro

Protein Sequence (241 amino acids)

>PFLU_RS19495 SDR family oxidoreductase (Pseudomonas fluorescens SBW25)
MNAAFNFTHHRILVTGASSGIGREIALQLIASGAEVFALGRDAQALAQLGCHALCLDIAD
STALDNALQALPPLHGLVNCAGISRLEPAAAISAEAFDQVMQVNARAAAQVGSRVAAKMI
EANIAGSIVNVSSQASLVALDDHLGYCASKAALDAITRVQCAEWGRFGIRVNSVNPTVTL
TPMAAMAWSDPSKRDPALAAIPLGRFAETVEVALPVLFLLSSAASMISGVSLPIDGGYTS
R