Protein Info for PFLU_RS19085 in Pseudomonas fluorescens SBW25

Annotation: cytochrome b

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 46 to 68 (23 residues), see Phobius details amino acids 88 to 112 (25 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 9 to 180 (172 residues), 87.7 bits, see alignment E=4.4e-29

Best Hits

Swiss-Prot: 40% identical to C56H_ECOLI: Cytochrome b561 homolog 1 (yodB) from Escherichia coli (strain K12)

KEGG orthology group: K12262, cytochrome b561 (inferred from 100% identity to pfs:PFLU3913)

MetaCyc: 36% identical to superoxide oxidase (Escherichia coli K-12 substr. MG1655)
RXN-20148 [EC: 1.10.3.17]

Predicted SEED Role

"cytochrome b(561)"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.10.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYI4 at UniProt or InterPro

Protein Sequence (185 amino acids)

>PFLU_RS19085 cytochrome b (Pseudomonas fluorescens SBW25)
MPWKNSDTRYSTMSIALHWLMVVLLAVVYACIELRGQFPKGSGARTLIVEMHFMFGLTVF
VLVWLRLFARSLGVAPKIVPAPPQWQSLLATLMHVALYALMIGMPIAGWLIVSAEGHSVM
FYGMELPPLIAENKDLAKQIEGWHVWFGKVGYWLIGLHALAGIAHHYILRDNTALRMMPG
KRANP