Protein Info for PFLU_RS18980 in Pseudomonas fluorescens SBW25

Annotation: acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 641 PF00289: Biotin_carb_N" amino acids 5 to 112 (108 residues), 141.4 bits, see alignment E=6.8e-45 PF02786: CPSase_L_D2" amino acids 118 to 324 (207 residues), 263.1 bits, see alignment E=7.6e-82 PF02222: ATP-grasp" amino acids 139 to 294 (156 residues), 41.4 bits, see alignment E=5.6e-14 PF07478: Dala_Dala_lig_C" amino acids 142 to 293 (152 residues), 47.7 bits, see alignment E=6.3e-16 PF02785: Biotin_carb_C" amino acids 338 to 445 (108 residues), 120.8 bits, see alignment E=1.3e-38 PF21139: MCC_alpha_BT" amino acids 460 to 552 (93 residues), 88.9 bits, see alignment E=1e-28 PF00364: Biotin_lipoyl" amino acids 572 to 637 (66 residues), 67 bits, see alignment E=4.6e-22

Best Hits

KEGG orthology group: K01968, 3-methylcrotonyl-CoA carboxylase alpha subunit [EC: 6.4.1.4] (inferred from 100% identity to pfs:PFLU3892)

Predicted SEED Role

"Methylcrotonyl-CoA carboxylase biotin-containing subunit (EC 6.4.1.4)" in subsystem HMG CoA Synthesis or Leucine Degradation and HMG-CoA Metabolism or Serine-glyoxylate cycle (EC 6.4.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.4.1.4

Use Curated BLAST to search for 6.4.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JYF4 at UniProt or InterPro

Protein Sequence (641 amino acids)

>PFLU_RS18980 acetyl/propionyl/methylcrotonyl-CoA carboxylase subunit alpha (Pseudomonas fluorescens SBW25)
MTTLTTVLVANRGEIACRVMRTAKAMGLTTVAVHSAIDRDARHSREADIRVDLGGSKATD
SYLQIDKLIAAAQASGAQAIHPGYGFLSENAGFARAIEAAGLIFLGPPASAIDAMGSKSA
AKALMETAGVPLVPGYHGEAQDLDTFRAACERIGYPVLLKATAGGGGKGMKVVEDVSQLA
EALASAQREALSSFGNGQMLVEKYLLKPRHVEIQVFADQHGHCLYLNERDCSIQRRHQKV
VEEAPAPGLSVEQRKAMGEAAVRAAQAIGYVGAGTVEFLLDARGEFFFMEMNTRLQVEHP
VTEAITGLDLVAWQIRVAQGEALPITQEQVPLIGHAIEVRLYAEDPANDFLPATGHLALY
RESTPRPGCRVDSGVEQGDSVSPFYDPMLGKLIAWGEDREQARLRLLGMLDEFAVGGLKT
NLGFLRRIIGHPAFAAAELDTGFIPRYQDELLPSPGELGDEFWQAAGAAYIQSLPPGEGP
WADKRGFRAGLPAEVSLHLSCNGQDRLVTLAADGAQLRGEQLLIEQQGVRRSHLAVRHGH
TMYLRWDGEMQAATLFDPIAAVEANQSHQGGLTAPMNGSIVRVLVEVGQNVEAGTPLVVL
EAMKMEHSIRAPQAGVVKALFCQEGEMVAEGCALVELETAG