Protein Info for PFLU_RS18650 in Pseudomonas fluorescens SBW25

Annotation: NADH-quinone oxidoreductase subunit NuoI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01971: NADH-quinone oxidoreductase, chain I
  • amino acids 18 to 139 (122 residues), 174.1 bits, E=3.8e-56
• PF00037: Fer4
  • amino acids 59 to 78 (20 residues), 22.3 bits, see alignment (E = 5e-08)
  • amino acids 95 to 117 (23 residues), 35.1 bits, see alignment (E = 4.4e-12)
• PF13237: Fer4_10
  • amino acids 59 to 112 (54 residues), 29.1 bits, E=4.5e-10
• PF12800: Fer4_4
  • amino acids 60 to 75 (16 residues), 16.3 bits, see alignment (E = 5.6e-06)
  • amino acids 99 to 113 (15 residues), 15.2 bits, see alignment (E = 1.3e-05)
• PF13187: Fer4_9
  • amino acids 61 to 116 (56 residues), 28.7 bits, E=5.9e-10
• PF12838: Fer4_7
  • amino acids 61 to 115 (55 residues), 45.3 bits, E=5.3e-15

Best Hits

Swiss-Prot: 100% identical to NUOI_PSEPF: NADH-quinone oxidoreductase subunit I (nuoI) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00338, NADH dehydrogenase I subunit I [EC: 1.6.5.3] (inferred from 97% identity to ppg:PputGB1_3698)

MetaCyc: 97% identical to NADH-quinone oxidoreductase subunit I (Pseudomonas putida KT2440)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain I (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (3/6 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

See C3JY88 at UniProt or InterPro

Protein Sequence (182 amino acids)

>PFLU_RS18650 NADH-quinone oxidoreductase subunit NuoI (Pseudomonas fluorescens SBW25)
MFKYIGDIVKGTGTQLRSLVMVFGHGFRKRDTLQYPEEAVYLPPRYRGRIVLTRDPDGEE
RCVACNLCAVACPVGCISLQKAETEDGRWYPDFFRINFSRCIFCGLCEEACPTTAIQLTP
DFEMAEFKRQDLVYEKEDLLISGPGKNPDYNFYRVAGMAVAGKPKGAAQNEAEPINVKSL
LP