Protein Info for PFLU_RS18495 in Pseudomonas fluorescens SBW25

Annotation: glycosyl transferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02885: Glycos_trans_3N
  • amino acids 27 to 83 (57 residues), 66.3 bits, E=8.5e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3794)

Predicted SEED Role

"Anthranilate phosphoribosyltransferase like (EC 2.4.2.18)" (EC 2.4.2.18)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• L-tryptophan biosynthesis (6/6 steps found)
• superpathway of chorismate metabolism (42/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.18

Use Curated BLAST to search for 2.4.2.18

Sequence Analysis Tools

See C3JY51 at UniProt or InterPro

Protein Sequence (333 amino acids)

>PFLU_RS18495 glycosyl transferase family protein (Pseudomonas fluorescens SBW25)
MTDFAPLTLETPAEHPFAPFVRILGKGKRGARNLTREEAREAMGMLLDEKVEDTQLGAFL
MLLRHKEESPEELAGFTEAVRERLHAPALNVDVDWPTYAGKKRHLPWYLLAAKCLAQNGV
RILMHGGGAHTAGRLYTEQLLEGLQIPLCRNWQQVESAYAQGNLAFIPLGDWAPQLQRMI
DLRNTLGLRSPIHSLARLLNPLQARLGLQSIFHPGYQGVHRDASGLLGDNVIVVKGDGGE
VEINPDTLSHLYGTTAGESWDEEWPALSAQRHVKPATLEPEHLKAVWRGDVEDSYPQLAL
IATMALALRGLGHPREQAFELAQQYWAARDKSI