Protein Info for PFLU_RS18460 in Pseudomonas fluorescens SBW25

Annotation: YIP1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 transmembrane" amino acids 32 to 57 (26 residues), see Phobius details amino acids 70 to 96 (27 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 165 to 192 (28 residues), see Phobius details PF04893: Yip1" amino acids 7 to 182 (176 residues), 147.9 bits, see alignment E=1.4e-47

Best Hits

Swiss-Prot: 52% identical to YOHC_ECOL6: Inner membrane protein YohC (yohC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3787)

Predicted SEED Role

"probable membrane protein YPO2362"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JY44 at UniProt or InterPro

Protein Sequence (200 amino acids)

>PFLU_RS18460 YIP1 family protein (Pseudomonas fluorescens SBW25)
MIHHVVGLFTHPDQEWREIRGDKEESIGHMYLTHTLILAAIPAVSAFIGTTQVGWVIGNR
APVMLTQESALWMTLMSYAAMLGGVAVMGAFIHWMARTYDANPSMARCVAFATYTATPLF
IGGLAALYPHMWLGMVVGTAAICYTVYLLYVGLPTFMSIDPDEGFLFSSSVLAVGLVVLV
AIMAFTVIVWGLGVGPIYTN