Protein Info for PFLU_RS18325 in Pseudomonas fluorescens SBW25

Annotation: sensor domain-containing diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 TIGR00229: PAS domain S-box protein" amino acids 7 to 124 (118 residues), 66.1 bits, see alignment E=3.2e-22 PF00989: PAS" amino acids 9 to 95 (87 residues), 43.8 bits, see alignment E=5.9e-15 PF13426: PAS_9" amino acids 18 to 116 (99 residues), 36.3 bits, see alignment E=1.4e-12 PF08448: PAS_4" amino acids 19 to 117 (99 residues), 29.8 bits, see alignment E=1.6e-10 PF08447: PAS_3" amino acids 29 to 97 (69 residues), 52.2 bits, see alignment E=1.5e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 125 to 282 (158 residues), 139.4 bits, see alignment E=9.1e-45 PF00990: GGDEF" amino acids 128 to 283 (156 residues), 156 bits, see alignment E=1.8e-49

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3760)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JY16 at UniProt or InterPro

Protein Sequence (290 amino acids)

>PFLU_RS18325 sensor domain-containing diguanylate cyclase (Pseudomonas fluorescens SBW25)
MPVDLQALYPKLIHLMLDTVFVVDGENQIVFVSDACEALLGYRAQELTGTLITHYMHPED
LARTRASIVRVMNGQPHVDFRNRYLRKDGSVVHILWAAFWSQEVGARIGVARDITALTQA
EEELRFLAHHDPLTALTNRSLFNARLDHALQTARSHNHTLALLFLDINDFKGINDVHGHA
MGDRVLCVIARRLERCVRENDLVARMGGDEFTVMITDIQSPDAVAGKVAQILAVMSEPLG
AEFGGVKMPTCSVGVAFYPGDGEDADTLLSHADGEMYRIKRQRFATEGRS