Protein Info for PFLU_RS18205 in Pseudomonas fluorescens SBW25

Annotation: aquaporin Z

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 237 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 38 to 61 (24 residues), see Phobius details amino acids 85 to 107 (23 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 203 to 225 (23 residues), see Phobius details PF00230: MIP" amino acids 6 to 223 (218 residues), 166.7 bits, see alignment E=3.5e-53 TIGR00861: MIP family channel proteins" amino acids 11 to 223 (213 residues), 187.3 bits, see alignment E=1.8e-59

Best Hits

Swiss-Prot: 65% identical to AQPZ2_AGRFC: Aquaporin Z 2 (aqpZ2) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K06188, aquaporin Z (inferred from 100% identity to pfs:PFLU3733)

MetaCyc: 63% identical to water channel AqpZ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-145

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JXV8 at UniProt or InterPro

Protein Sequence (237 amino acids)

>PFLU_RS18205 aquaporin Z (Pseudomonas fluorescens SBW25)
MESIVQKRLTAEFIGTFWLTFGGCGSAILAAAFPGLGIGFVGVSLAFGLTVLTMAYAVGG
ISGGHFNPAVTIGLWAGRRIDGADVLPYIAAQVCGAIVAAAALYLIANGQPDFAVGGFAA
NGYGPLSPGLFDVKAALLAELIATFFFVFIIMRVTAPGAVPGFAPIAIGLALTLIHLVLI
PVTNTSVNPARSTGPALFAGGEYIAQLWMFWLAPVVGGVMGAWAARSLGDGDKPTPA