Protein Info for PFLU_RS18185 in Pseudomonas fluorescens SBW25

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 9 to 199 (191 residues), 170 bits, E=6.7e-54
• PF08659: KR
  • amino acids 12 to 189 (178 residues), 33.6 bits, E=5.7e-12
• PF13561: adh_short_C2
  • amino acids 15 to 251 (237 residues), 192.5 bits, E=1.3e-60

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3729)

MetaCyc: 37% identical to NAD(P)+-dependent L-rhamnose 1-dehydrogenase (Sphingomonas sp. SKA58)
RXN-12158 [EC: 1.1.1.378]; L-rhamnose 1-dehydrogenase. [EC: 1.1.1.378, 1.1.1.173]

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

• L-rhamnose degradation II (4/8 steps found)
• L-rhamnose degradation III (3/7 steps found)

KEGG Metabolic Maps

• Fructose and mannose metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.173 or 1.1.1.378

Sequence Analysis Tools

See C3JXV4 at UniProt or InterPro

Protein Sequence (254 amino acids)

>PFLU_RS18185 SDR family oxidoreductase (Pseudomonas fluorescens SBW25)
MQLFSLQGQVAFVTGAGSGIGQAIAVGLAEAGADVACFDLPGSPGIASTVERIQALGRRA
LALSGTVTERAALDAAVARTESELGALSVAVNCAGIANAQAAEDLELQRWQTTLDINLTG
IFLSCQAQAAVMLPRGKGAIVNIASMSGSIVNRGLLQAHYNTSKAGVIHLSKSLAMEWAD
KGLRVNCISPGYTATPMNSRPEVADQVKIFEQTTPMGRMASVEEMVGPAIFLVSQASSFC
TGVDLLVDGGFVCW