Protein Info for PFLU_RS17995 in Pseudomonas fluorescens SBW25

Annotation: LLM class flavin-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 82 to 105 (24 residues), see Phobius details TIGR03860: FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family" amino acids 14 to 430 (417 residues), 531.6 bits, see alignment E=6.7e-164 PF00296: Bac_luciferase" amino acids 33 to 388 (356 residues), 174.3 bits, see alignment E=2.1e-55

Best Hits

Swiss-Prot: 55% identical to MOXC_BACSU: Putative monooxygenase MoxC (moxC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3690)

MetaCyc: 55% identical to N-acetyl-S-alkylcysteine sulfoxide C-monooxygenase (Bacillus subtilis subtilis 168)
1.14.14.-

Predicted SEED Role

"Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JXR8 at UniProt or InterPro

Protein Sequence (454 amino acids)

>PFLU_RS17995 LLM class flavin-dependent oxidoreductase (Pseudomonas fluorescens SBW25)
MSKPHQAKPRHLKLGAMVHGVGHGWGEWRHPNAQPNASTSFGFYKQQTELAEAAKFDFVF
IADSLHIHAKSSPHYLNRFEPLTILSALAAITTNIGLVATVTVSYTEPYQVARQFSSLDH
ISGGRAGWNVVTSWLSGTADNFSKAEHPPHAVRYRIAKEHVNTVQGLWDSWEDDAFTYNK
QTGEFFAPSKLHALNHKGDFFSVKGPLNIARSRQGQPVIFQAGTSEDGRNFAAQNADAIF
VHVDSIEEGLAYSQDLKRRAKGFGRDPQSLSILPGIRPIVGRDEAEVESRYQQAVDLVTV
EDAIVALGRPFNDHDFSKYPLDAPFPELGDLGSNSQKGGSDRIKQLAKDEGLTLREVALH
FSRPKRDFVGTPEQVADAIQAWFETGASDGFIINSVLPDGLQYFTEWVVPVLQQRGLFRS
EYTGHTLRDNLGLDVPANRYSVAAEVEEKQEALA