Protein Info for PFLU_RS17975 in Pseudomonas fluorescens SBW25

Annotation: cysteine dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05995: CDO_I
  • amino acids 50 to 162 (113 residues), 27.6 bits, E=1e-10

Best Hits

Swiss-Prot: 68% identical to 3MDO_PSEAE: 3-mercaptopropionate dioxygenase (PA2602) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3685)

Predicted SEED Role

"Cysteine dioxygenase (EC 1.13.11.20)" (EC 1.13.11.20)

MetaCyc Pathways

• L-cysteine degradation I (2/3 steps found)
• taurine biosynthesis I (2/3 steps found)
• superpathway of L-methionine salvage and degradation (9/16 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Taurine and hypotaurine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.20

Sequence Analysis Tools

See C3JXR5 at UniProt or InterPro

Protein Sequence (203 amino acids)

>PFLU_RS17975 cysteine dioxygenase (Pseudomonas fluorescens SBW25)
MTQARHPERLRAFIGALAELIDGNPREGDLLHRGGKLLAQLVSHDDWLPDEYAQPDPERY
QQFLLHADSRQRFSIVSFVWGPGQSTPIHDHRVWGLIGMLRGAEFSQGFERAPDGRLVAE
GKPIQLVPGQVEAVSPKVGDIHQVSNAHSDQVSISIHVYGANIGAVRRAVYQPDGSEKLF
ISGYSNAFLPNIWDLSKEKSPAL