Protein Info for PFLU_RS17910 in Pseudomonas fluorescens SBW25

Annotation: O-antigen ligase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 133 to 152 (20 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details amino acids 218 to 235 (18 residues), see Phobius details amino acids 241 to 258 (18 residues), see Phobius details amino acids 265 to 284 (20 residues), see Phobius details amino acids 365 to 386 (22 residues), see Phobius details amino acids 396 to 414 (19 residues), see Phobius details amino acids 420 to 437 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 227 to 374 (148 residues), 41.6 bits, see alignment E=5.5e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3672)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JXQ3 at UniProt or InterPro

Protein Sequence (440 amino acids)

>PFLU_RS17910 O-antigen ligase family protein (Pseudomonas fluorescens SBW25)
MQSFASPDTVSLRERYRVRVVSAFVLIYLFILFEGILRKWVMPGLSSAIYFIKDPIVLYI
YWCAYRFGFFSKNLVSAYFVVLVLVFFVLVSAFLLTRPEGFVIYGYGVRNYLLYFPLIFV
AGKTIRLTDVYRFARITLFAAIPISVLVVLQYSSGPQAYVNKGIGDDDFIFMIADGVVRP
YGTFTFTAGHVVYVSACFAFLVAAIFDKALFRAVFARRYVLFGVSAASVAVMCFLTGSRA
IYAYAAIVLLAALMVALIKKSQRNLLSLFFLAAALFVSLLIFMSTDSYQVLVERNRSAVA
SEGSPVTRAFSSLYAFTRVVDDAPLWGHGIGSGTNAASTILRAGREQGAGFLLAEDEWSR
IVLEMGLPAGLMFILFRVFVLLWLLLRSYKALVRQGTGVPLLLCGFLAPILFNGVMTMQG
TFLAFGVLYACLILAACKKT