Protein Info for PFLU_RS17615 in Pseudomonas fluorescens SBW25

Annotation: DeoR/GlpR transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF08279: HTH_11" amino acids 14 to 55 (42 residues), 32.4 bits, see alignment 1.1e-11 PF08220: HTH_DeoR" amino acids 14 to 64 (51 residues), 64.4 bits, see alignment 9.7e-22 PF00455: DeoRC" amino acids 83 to 239 (157 residues), 144.7 bits, see alignment E=3.6e-46

Best Hits

Swiss-Prot: 32% identical to GOLR_LISIN: HTH-type transcriptional regulator GolR (golR) from Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3612)

Predicted SEED Role

"Galactitol utilization operon repressor" in subsystem D-Tagatose and Galactitol Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JXI4 at UniProt or InterPro

Protein Sequence (261 amino acids)

>PFLU_RS17615 DeoR/GlpR transcriptional regulator (Pseudomonas fluorescens SBW25)
MHNTHHAIDLPSLRKQKILLLLERDGKVTASELVEHFAVSQDTIRRDLGELAAAGLLQRV
HGGALPRPKDTGKDFFTRVGETNEAKRRLARLAAERVEEGQIVLFDSGSTTLQIAQSLPR
SMRLTVVTPSPMIAIALADHPDVKVILTGGQLNPATLSTSGQETVRMIQSIKADLLFTGV
CALHPQVGISSLHFDEVAVKQALLDSASHVVAVTMADKLGAVEPFVVAPCSRIHTLITEW
HVPSVEAYEQLGLEVLRVEVE