Protein Info for PFLU_RS17595 in Pseudomonas fluorescens SBW25
Annotation: GDP-mannose pyrophosphatase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to NUDK_PECAS: GDP-mannose pyrophosphatase NudK (nudK) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3608)MetaCyc: 53% identical to GDP-mannose hydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-
Predicted SEED Role
"Nudix hydrolase family protein YffH" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See C3JXI0 at UniProt or InterPro
Protein Sequence (195 amino acids)
>PFLU_RS17595 GDP-mannose pyrophosphatase (Pseudomonas fluorescens SBW25) MDNSTVRITAEETLSENWYLLKKYSFDLRRRDGSWQAQTREVYDRGNGATILLYNREQRT VLLIRQFRMPTFVNDYHGYLIEAAAGLLDNASPEERIRLEAEEETGYRVGHVEKIYAAFM SPGSVTERIHFFMGEYQPGDRVGTGGGLEEEGEDIEVLELGFEEALAKVQNGEIADGKTI MLLQHLELRMLKEGW