Protein Info for PFLU_RS17560 in Pseudomonas fluorescens SBW25

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 transmembrane" amino acids 49 to 65 (17 residues), see Phobius details PF00512: HisKA" amino acids 202 to 262 (61 residues), 31.2 bits, see alignment E=2.7e-11 PF02518: HATPase_c" amino acids 306 to 425 (120 residues), 69.4 bits, see alignment E=5.5e-23 PF00072: Response_reg" amino acids 448 to 560 (113 residues), 53.4 bits, see alignment E=4.2e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3601)

Predicted SEED Role

"sensory box histidine kinase/response regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3JXH3 at UniProt or InterPro

Protein Sequence (570 amino acids)

>PFLU_RS17560 response regulator (Pseudomonas fluorescens SBW25)
MQFLSNTHGCEGWGGEMAQRIRAFDWSTTELGPIDKWPCSLSSTVQMLLASPMPMVMLWG
SVGYMIYNDSYSVFAGGRHPYLLGKPVELGWPEVADFNRHVLDTCLAGGTLSYRDFPLEL
SRNGQPEEVWMDLSYSPVADDNQQPAGVLVIVTETTEHVKSERVRQELTHNLEQRVADEV
QARSAAEDQLRQSQKLEAIGGLTGGVAHDFNNLLQVIAGNLHLLSRHEPDNPQVQRRVAA
AIAAVERGAKLSSQLLAFARRQPLSPAVYNPQRIYAGLGELLQRALGETIHIDVQLPQDS
WCINVDRNQLENALLNLAINARDAMKGEGVIRITGENIILNPGDCAGKSIKPGEYVGLAV
TDIGVGMPPAILARVFEPFFTTKRNGHGTGLGLSMVFGFVRQSGGHVEVWSEEGKGTVVQ
MYFPRSLGDEAEEAHAEPVSHANGHETILVVEDNEDVRATVVELLEQSGYTVLTAEDGDR
AMHMLQAGVQPELIFTDVVMPGRIKSTDLAAWARAQTPPVAVLFTSGHTRDILSSNHLLS
PDIHLLSKPYSPEALAQRIRSVLSVRQGCS