Protein Info for PFLU_RS17325 in Pseudomonas fluorescens SBW25

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF12146: Hydrolase_4" amino acids 18 to 120 (103 residues), 30 bits, see alignment E=6.4e-11 PF00561: Abhydrolase_1" amino acids 18 to 128 (111 residues), 55.1 bits, see alignment E=1.9e-18 PF12697: Abhydrolase_6" amino acids 19 to 256 (238 residues), 71.2 bits, see alignment E=4.1e-23 PF08386: Abhydrolase_4" amino acids 205 to 263 (59 residues), 23.7 bits, see alignment E=8.6e-09

Best Hits

Swiss-Prot: 43% identical to RSBQ_BACSU: Sigma factor SigB regulation protein RsbQ (rsbQ) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3554)

Predicted SEED Role

"Hydrolase of unknown specificity RsbQ, part of a novel [RsbQ - PAS domain] bacterial sensing module"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K7V4 at UniProt or InterPro

Protein Sequence (271 amino acids)

>PFLU_RS17325 alpha/beta hydrolase (Pseudomonas fluorescens SBW25)
MDLLHRNNVSVMGSGTSTLVFSHGFGCNQAMWNYLAPHFLERFRVVMYDLVGAGLSDLSA
FDKAKYSTLDGYARDLNEIIDAYAVGPVILVGHSVSAMIGALADRLAPGRVAAHVMIGPS
PRYIDDDGYIGGFKHSDIDDLLDTLDSNYLGWSSAMAPVIMGAQGQSALGVELTESFCRT
EPEIAKQFARVTFMSDNRQDVIGLATPVLILQSTDDLIAPVAVGEYLHRVLPNSSYCLVD
NIGHCPHMSAPQACATAMDSFLAHWAAARAS