Protein Info for PFLU_RS17240 in Pseudomonas fluorescens SBW25

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF06342: DUF1057
  • amino acids 33 to 158 (126 residues), 23.2 bits, E=8.2e-09
• PF00561: Abhydrolase_1
  • amino acids 58 to 298 (241 residues), 100 bits, E=4.6e-32
• PF12697: Abhydrolase_6
  • amino acids 59 to 306 (248 residues), 80.7 bits, E=6.4e-26
• PF12146: Hydrolase_4
  • amino acids 59 to 192 (134 residues), 57.3 bits, E=3.8e-19
• PF00756: Esterase
  • amino acids 127 to 180 (54 residues), 23.1 bits, 1.4e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3536)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• aromatic compounds degradation via β-ketoadipate (9/9 steps found)
• superpathway of salicylate degradation (7/7 steps found)
• catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
• catechol degradation to β-ketoadipate (4/4 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
• toluene degradation III (aerobic) (via p-cresol) (8/11 steps found)
• 4-methylcatechol degradation (ortho cleavage) (4/7 steps found)
• mandelate degradation to acetyl-CoA (7/18 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (19/35 steps found)
• superpathway of aerobic toluene degradation (10/30 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

See C3KE34 at UniProt or InterPro

Protein Sequence (332 amino acids)

>PFLU_RS17240 alpha/beta hydrolase (Pseudomonas fluorescens SBW25)
MAVEWVIAAAVLIGASAVLWGFSVWMTRRIEAAVPNNGRFVEVDGERFHYYEEGKGRPLV
MIHGLMGSSRNLTYALSGQLREHFRVITLDRPGSGYSTRHTGTAADLPAQARQVAAFIHT
LGLDKPLVLGHSLGGAISLALALDHPHTVSGLVLVAPLTHPQPTLPLVFWSLAVRPAWLR
RWVSYTLTVPMGLLTRRAVVKGVFAPDSAPEDFATRGGGLLGMRPENFYAASSEIALVND
ELPDMVKRYPQLTLPISLIYGARDKVLDFRKHGQALADKVPGLKLQVVEGRGHMLPITAT
ERVVEAVHQLAKRARPLETAEILHPPFALANK