Protein Info for PFLU_RS16825 in Pseudomonas fluorescens SBW25

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 PF14361: RsbRD_N" amino acids 4 to 108 (105 residues), 26.5 bits, see alignment E=1.3e-09 PF00512: HisKA" amino acids 151 to 212 (62 residues), 48 bits, see alignment E=1.6e-16 PF02518: HATPase_c" amino acids 261 to 373 (113 residues), 68.2 bits, see alignment E=1.3e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3447)

Predicted SEED Role

"Sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KCF6 at UniProt or InterPro

Protein Sequence (374 amino acids)

>PFLU_RS16825 sensor histidine kinase (Pseudomonas fluorescens SBW25)
MRLPDFILANLEPILQAWEDFARTIQTPGADLDRAGLRDHAEQMLHAIVLDLRTSQTVQE
QTEKAQGLAPQNDTESPAETHAVTRLMAGFSIDQMVSEYRALRTSVLSQWLDQIKHGTAL
QVDDMNRFHEAIDQALAESIASYSRAVEASRNVFLGILGHDLRTPLGAILLGADMLRRSP
ALGERNTRVATQIYTSVQRASQIVGDLLDLTRCQMGPGIPVKRTAVDLAPICERIVDEIR
AFHPDSHILFEATTQATGAFDGPRMEQVFSNIISNAVQHGDARSPIKVQLSASAETLVFA
VHNRGNPIPVDVLPFIFNPMGRFSQRAVIEHGPTEGLGLGLFIASEIVASHQGLIEVESS
LASGTVFRATVPLY