Protein Info for PFLU_RS16335 in Pseudomonas fluorescens SBW25

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF07638: Sigma70_ECF" amino acids 38 to 190 (153 residues), 23.7 bits, see alignment E=8.3e-09 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 52 to 209 (158 residues), 84.3 bits, see alignment E=3.7e-28 PF04542: Sigma70_r2" amino acids 56 to 123 (68 residues), 59.7 bits, see alignment E=3.9e-20 PF08281: Sigma70_r4_2" amino acids 155 to 205 (51 residues), 36.7 bits, see alignment E=5.3e-13 PF04545: Sigma70_r4" amino acids 158 to 207 (50 residues), 31.4 bits, see alignment E=2.2e-11

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 74% identity to pfl:PFL_5720)

Predicted SEED Role

"RNA polymerase sigma-70 factor" in subsystem Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (211 amino acids)

>PFLU_RS16335 sigma-70 family RNA polymerase sigma factor (Pseudomonas fluorescens SBW25)
MNGTTARCGLTSGCNRHLAPHDLIVWRKAIPIADIDQLKHLLAQCSLGDRRAFETLYRSV
SPRLHGVALRLMGRSDLAEEVLQESFVRIWNNASRYQSHLSAPMTWMISITRNQAIDQLR
KYRDRPLNDLDAQMLVDDSPSAHEQLNSSREASTLHRCLDKLEGMQRQSITIAYFGGLSC
SELAEHLSAPLGSVKSWIRRGMEHLRRCLES