Protein Info for PFLU_RS16060 in Pseudomonas fluorescens SBW25

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 580 transmembrane" amino acids 515 to 529 (15 residues), see Phobius details PF12418: AcylCoA_DH_N" amino acids 3 to 35 (33 residues), 38.4 bits, see alignment (E = 2.6e-13) PF02771: Acyl-CoA_dh_N" amino acids 42 to 158 (117 residues), 24.9 bits, see alignment E=5.5e-09 PF02770: Acyl-CoA_dh_M" amino acids 163 to 267 (105 residues), 64 bits, see alignment E=2.9e-21 PF00441: Acyl-CoA_dh_1" amino acids 277 to 443 (167 residues), 75.9 bits, see alignment E=9.6e-25 PF12806: Acyl-CoA_dh_C" amino acids 475 to 574 (100 residues), 45.9 bits, see alignment E=1.5e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3296)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7

Use Curated BLAST to search for 1.3.8.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KC96 at UniProt or InterPro

Protein Sequence (580 amino acids)

>PFLU_RS16060 acyl-CoA dehydrogenase (Pseudomonas fluorescens SBW25)
MWSYEAPLRDMQFVLEHWLQAPDTWRRSPAFEALDLPLALQVLEEAARFSQGVLAPLNSQ
GDRQGCRWQAGQVSTPDGFVEAYRAYVEGGWPALACAEAAGGQGLPQLLEAALQEMLYAS
NHAWAMYTGIAHGAYLCLKAHAAPWLQARYLPEIVSGQTLPTMCLTEPQAGSDVGLLRCR
AEPQADGSYRLSGSKIFISGGEHDLTANILHLVLARVPDAPPGSRGISLFLVPKQLDDGQ
PNGVRCDGIEHKMGIKGSATCSLVFDGAQGWLIGATNRGLAAMFVMMNSARLHVGLQGLG
HVEAAWQNARQYAAERLQMRAPSRPEEVVAQAADPIRYHPAMRRVLLELRTTSEGMRAIG
YWAAHLLDQAEHDQDSSAAQLAPLLTPIIKAFFTEQGFRQASHALQVFGGYGYVTEFAIE
QTLRDSRIAMIYEGSNEIQANDLLLRKVLGDEGRAFGLLLDAFRAEAGQGGQSVECAGFC
GALGSLCDALARVVSAIRERAHEDSEYPYRAAPDFLQLCGVALLAFAWARAARVSRALPD
DDPLRAAKLQSAGFFFDYLPSRLAQHLGAIDGARAALAFI