Protein Info for PFLU_RS16010 in Pseudomonas fluorescens SBW25

Annotation: APC family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 41 to 67 (27 residues), see Phobius details amino acids 92 to 120 (29 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 240 to 258 (19 residues), see Phobius details amino acids 297 to 323 (27 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 370 to 397 (28 residues), see Phobius details amino acids 409 to 429 (21 residues), see Phobius details amino acids 440 to 460 (21 residues), see Phobius details PF13520: AA_permease_2" amino acids 17 to 433 (417 residues), 109.1 bits, see alignment E=2.7e-35 PF00324: AA_permease" amino acids 38 to 398 (361 residues), 68 bits, see alignment E=6.9e-23

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3287)

Predicted SEED Role

"Cationic amino acid transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KC87 at UniProt or InterPro

Protein Sequence (499 amino acids)

>PFLU_RS16010 APC family permease (Pseudomonas fluorescens SBW25)
MSINDRLTQHLKRGSVGFPTALASTIGLIMASPVILTATMGFGIGGSAFAVAMLIAVVMM
LAQATTFAEAASILPTTGSVYDYINCGMGRFFAITGTLSAYLIVHVFAGTAETILSGVMA
LVNFEHLNTLAESAGGSWLLGVGFVVVFGILNAFGVSAFGRAEIILTFGMWTTLMVFGVM
GLIAAPAVQLEGWFGVSLVGTDLITILSLVGMAMFMFVGCEFVTPLAPDLRNSAKVMPKA
MIFGLLSVATCMFIYGAAMKRQVENVLLDAATGVHLLDTPMAIPRFAEQVMGDIGPLWLG
LGFLFAGAATINTLMAGVPRILYGMAVDGALPKVFTYLHPRFKTPLLCILVAMLIPCLYA
LWLGGNTDNIMHLVLAAVCAWSFSYLLVTLSVVILRIRRPDLPRAYRSPLFPLPQILSSV
GILLGMWFITPPGMNPADIYVPFGVMLGITAAYALFWTLVVQKVNPFKPASVEEVLAKEF
SHEPGNVHNAYLEQAAKAV