Protein Info for PFLU_RS15835 in Pseudomonas fluorescens SBW25

Annotation: His-Xaa-Ser system radical SAM maturase HxsB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 495 TIGR03978: His-Xaa-Ser system radical SAM maturase HxsB" amino acids 13 to 480 (468 residues), 573.4 bits, see alignment E=1.8e-176 PF13353: Fer4_12" amino acids 95 to 205 (111 residues), 30.3 bits, see alignment E=5.1e-11 PF04055: Radical_SAM" amino acids 103 to 269 (167 residues), 49 bits, see alignment E=8.2e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3249)

Predicted SEED Role

"His-Xaa-Ser system radical SAM maturase HxsB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KCX8 at UniProt or InterPro

Protein Sequence (495 amino acids)

>PFLU_RS15835 His-Xaa-Ser system radical SAM maturase HxsB (Pseudomonas fluorescens SBW25)
MTLIATDAKHYRLLPFRFMRMSMGNDRDILLTSDTGEYMHVNNAQLRALSYFDVQASTPF
YKDLLARHFIYEPGRHDPFPEMAAQYRSRKDFLFQGPALHLFVVTLRCNHTCQYCQVSRA
PLGGSNHDLSEADAQAAVDRLFESNAPALTVEFQGGEPLLAFERVRQIVEWVVERNVVEQ
REIQFVITTTLHHLTEEILDFAEQHRIQFSTSLDGPAPLHNANRPTPSRDSYERTVKGIQ
WVRERLGHDAVSALTTLTSRSLEQPEAIIDEYVSQGFSSISLRPLSPYGFATKSAHRLDY
PIERYLAFYKKALAYLLHINQQGVYLSESYTSLLLKNILTPFSSGYVDLRSPAGAGTAAL
VYNYDGYVYPSDEARMLLEMGEDGLRLGTVHQPLSDLLTSPVMNALLASGVAEALPGCSD
CALVPYCGADPVEHYARQADPIGHRVFSSFCKKNMGLLKHLFGLLCDGDDNVQRVLLSWL
NRRSYNDVRFPGYRG