Protein Info for PFLU_RS15750 in Pseudomonas fluorescens SBW25

Annotation: type II secretion system secretin GspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 788 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR02517: type II secretion system protein D" amino acids 101 to 732 (632 residues), 671.4 bits, see alignment E=6e-206 PF21305: type_II_gspD_N0" amino acids 101 to 168 (68 residues), 78.3 bits, see alignment E=4.9e-26 PF03958: Secretin_N" amino acids 196 to 256 (61 residues), 52.7 bits, see alignment 6.2e-18 amino acids 259 to 327 (69 residues), 44 bits, see alignment E=3.2e-15 amino acids 333 to 470 (138 residues), 47.5 bits, see alignment E=2.5e-16 PF00263: Secretin" amino acids 554 to 723 (170 residues), 164.9 bits, see alignment E=2e-52

Best Hits

KEGG orthology group: K02453, general secretion pathway protein D (inferred from 100% identity to pfs:PFLU3232)

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KC62 at UniProt or InterPro

Protein Sequence (788 amino acids)

>PFLU_RS15750 type II secretion system secretin GspD (Pseudomonas fluorescens SBW25)
MKWSGSNYVRNAAPFLLLALSACSTQTASNAPPLLVDSELGQPLANTQRSGDVLLERQRA
QTQIERQARPQRTLVNPVRRGGASIGGTTLSNPLGSQPVSLNFVDADIQAVVRGLSRATG
RQFLVDPRVTGSLTLVSEGEVPAHQAYDMLLAALRMQGFSVVDVGGVAHVVPEADAKLLG
GPVYSADRPAANGMLTRTFRLHYENAVNLIPVLRPIVSPNNPINAYPGNNTLVITDYADN
LARVAQLIDSIDSPSAIDTDVVQVQNGIAVDIAGMVSQLLEQPGSDATQKISVVGDPRSN
SIIIRAGSPERTELARNLVYKLDNAQSNPSNLHVVYLRNAQAAKLAQALRGLLTGESDSG
TGDTGRSVLSAMGGNTSGGQSGQNSPSSTSQTSSSGSSSSNGTGMGYGQSGGNSSSQAGA
QATDQSVAFSAGGVTIQADATTNTLLISAPEPLYRNLREVIDMLDQRRAQVVIESLIVEV
GEDDANEFGVQWQSGDLAGKGVIGGTNLGGSGLQTGGLTSIDALPGGLSVGYLSGTVNIP
GVGNVMDLKVLARALKSKGGSNVLSTPNLLTLDNEAASIFVGQTIPFVSGSYVTGGGGTS
NNPFQTVTREEVGLKLNVRPQISEGGTVKLDIYQEVSSIDERASSSATSAGVVTNKRAID
TSILLDDGQIMVLGGLLQDGYSQSNEAVPWLSSIPGLGALFRNERRATTKTNLMVFLRPY
IIRDSAGGRAITLNRYDFIRRAQGALQPERSWAMPGMQAPQLPAAAVGVPAAPGSGQPRA
TIRAVPLQ