Protein Info for PFLU_RS15525 in Pseudomonas fluorescens SBW25

Annotation: helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 PF01638: HxlR" amino acids 23 to 108 (86 residues), 125.9 bits, see alignment E=2.3e-41

Best Hits

Swiss-Prot: 61% identical to YDEP_BACSU: Uncharacterized HTH-type transcriptional regulator YdeP (ydeP) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3185)

Predicted SEED Role

"Transcriptional regulator, HxlR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KC16 at UniProt or InterPro

Protein Sequence (129 amino acids)

>PFLU_RS15525 helix-turn-helix transcriptional regulator (Pseudomonas fluorescens SBW25)
MKKCTPQSEVEAFACPVAFTVDVIGGKWKSLILFHLMSGTKRFNELRRLMPDVTQRMLTL
QLRELETDKVIHREIYREVPPKVEYSLTALGNTLAPLISAMREWGAVHEHAILAFRRAEI
DANSFESLA