Protein Info for PFLU_RS15025 in Pseudomonas fluorescens SBW25

Annotation: 2-keto-4-pentenoate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3080)

Predicted SEED Role

"4-oxalocrotonate decarboxylase (EC 4.1.1.77)" in subsystem Benzoate transport and degradation cluster (EC 4.1.1.77)

MetaCyc Pathways

• 3-chlorocatechol degradation III (meta pathway) (2/4 steps found)
• orthanilate degradation (2/5 steps found)
• protocatechuate degradation III (para-cleavage pathway) (2/5 steps found)
• 2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (1/4 steps found)
• 2-aminophenol degradation (1/4 steps found)
• catechol degradation to 2-hydroxypentadienoate II (1/4 steps found)
• 4-amino-3-hydroxybenzoate degradation (2/6 steps found)
• 2,3-dihydroxybenzoate degradation (1/5 steps found)
• 2-nitrobenzoate degradation I (1/7 steps found)
• catechol degradation II (meta-cleavage pathway) (1/7 steps found)
• L-tryptophan degradation IX (4/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (4/12 steps found)
• 4-chloronitrobenzene degradation (1/9 steps found)
• 4-nitrotoluene degradation II (1/9 steps found)
• 2,2'-dihydroxybiphenyl degradation (1/10 steps found)
• meta cleavage pathway of aromatic compounds (1/10 steps found)
• toluene degradation IV (aerobic) (via catechol) (2/13 steps found)
• superpathway of aerobic toluene degradation (10/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (13/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Fluorene degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.77

Sequence Analysis Tools

See C3KB90 at UniProt or InterPro

Protein Sequence (259 amino acids)

>PFLU_RS15025 2-keto-4-pentenoate hydratase (Pseudomonas fluorescens SBW25)
MSIDTAVLSQLDHATRTVQAIAPLVPEALDLRGGYALQRRALDVRLAAGEQLSGWKIAFA
GSAAQRRFGIDEPVYGGLTDQMCVPSNTAVALSRLIQPKLEVEVAIVLGRSLPPGNYSDA
EILAAIAEVAPAFEIADCRWQGWSFGVGAFLADNAAAGLYCLGPRTVFDPVEHANVAFRL
ECAGAICGEGETQGREDPPLANLCWLIRRLLADGQPVEARQVVLSGALLTPMEIQPTTYR
LQMFGTELALLFTTDTAAV