Protein Info for PFLU_RS14935 in Pseudomonas fluorescens SBW25

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 45 to 67 (23 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 152 to 170 (19 residues), see Phobius details amino acids 190 to 215 (26 residues), see Phobius details amino acids 222 to 246 (25 residues), see Phobius details amino acids 308 to 329 (22 residues), see Phobius details amino acids 331 to 377 (47 residues), see Phobius details PF00375: SDF" amino acids 11 to 401 (391 residues), 361.3 bits, see alignment E=3.3e-112

Best Hits

Swiss-Prot: 57% identical to DCTA_LARHH: C4-dicarboxylate transport protein (dctA) from Laribacter hongkongensis (strain HLHK9)

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3062)

MetaCyc: 56% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"C4-dicarboxylate transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAF1 at UniProt or InterPro

Protein Sequence (443 amino acids)

>PFLU_RS14935 dicarboxylate/amino acid:cation symporter (Pseudomonas fluorescens SBW25)
MGDAMKVVKSLYFQILFAVLLGVLVGHFWSQQAIAFKPLGDAFIKLIKMMIAPVVFCTIV
TGIAGMSDKRSLGRLLSKTMLLFLALTVISLIIGLVSVYVFKPGVGMNIDPTQLSTKGLS
QYTDSAAKLGVVEFFMHIIPDTFIGAFNKGEVLPVLFIAVLCGFALSAIGERGKPVLDVL
ESASQMVFKIFSYLMRFAPIGAFGALAFTVGQYGITSLGSLAKLIMTLYIACAFFVFAVL
GSICRANGFSLWKLLRYFREEFLVVLGTSSTEPVMPRMLEKLQALGCKKGVVGLVLPTGY
SFNLDGTAIYLSLAAVFIAQACNIELSLSQTLTMLAIMLLSSKGAAGVTGAGFVALASTL
TVIHDIPLAGLALLIGIDRFMSEARALTSLASNAVATVVMSISENACDRETLMRTLDGKP
SPAAPPNQVQNADWDGLKVTEQA