Protein Info for PFLU_RS14930 in Pseudomonas fluorescens SBW25

Annotation: TRAP transporter large permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 97 to 124 (28 residues), see Phobius details amino acids 136 to 154 (19 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 232 to 250 (19 residues), see Phobius details amino acids 255 to 273 (19 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 349 to 366 (18 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details amino acids 410 to 433 (24 residues), see Phobius details TIGR00784: citrate transporter" amino acids 1 to 432 (432 residues), 660.4 bits, see alignment E=7.5e-203 PF03553: Na_H_antiporter" amino acids 10 to 167 (158 residues), 29.9 bits, see alignment E=5.5e-11 PF03600: CitMHS" amino acids 14 to 378 (365 residues), 126.2 bits, see alignment E=2.4e-40 PF06808: DctM" amino acids 234 to 426 (193 residues), 26.3 bits, see alignment E=5e-10

Best Hits

Swiss-Prot: 68% identical to YRAO_BACSU: Uncharacterized transporter YraO (yraO) from Bacillus subtilis (strain 168)

KEGG orthology group: K03300, citrate-Mg2+:H+ or citrate-Ca2+:H+ symporter, CitMHS family (inferred from 100% identity to pfs:PFLU3061)

Predicted SEED Role

"Uncharacterized transporter, similarity to citrate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAF0 at UniProt or InterPro

Protein Sequence (434 amino acids)

>PFLU_RS14930 TRAP transporter large permease subunit (Pseudomonas fluorescens SBW25)
MLAFLGLAMVVVFTYLIMSKRLSPIVALTVVPIVFAVIGGFGGTTGKMMLDGLKMVAPSA
ALLLFAILFFGLMIDAGLFDPLIRKILKRVNGDPMKIAIGTALLSLVVALDGDGTTTYMI
TCAAMLPLYKRVGMNPMILATIAMLSLSIMSGMTPWGGPATRAIAALGLDAGEYFVPLLP
TMIGGAIWVVFTAFLLGRAERKRIGNVQLQSGGGDCYIDAILGDTPHKRPKLAYVNLVLV
IAVMVALVMGIMHSAILFLIGFVLALMINYPQLDIQKERILAHSGNAMTVVLLVFAAGIF
AGIFSGTKMVDSLAQTLVDWIPPSWGHLFPLVVAITSMPLTFVLSNDAYYFGVVPILANA
AAAYGIDPVEIARASILGQPVHLMSPLVASTLLLVGMVDRDIGDFQKATVKWAVLTSLVI
TAIALLTGAISLFT