Protein Info for PFLU_RS14725 in Pseudomonas fluorescens SBW25

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 PF00072: Response_reg" amino acids 10 to 121 (112 residues), 76.5 bits, see alignment E=2.7e-25 PF00512: HisKA" amino acids 169 to 241 (73 residues), 42.3 bits, see alignment E=9.5e-15 PF02518: HATPase_c" amino acids 287 to 394 (108 residues), 95.3 bits, see alignment E=4.8e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU3020)

Predicted SEED Role

"Chemotaxis regulator - transmits chemoreceptor signals to flagelllar motor components CheY" in subsystem Bacterial Chemotaxis or Flagellar motility or Two-component regulatory systems in Campylobacter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KAB1 at UniProt or InterPro

Protein Sequence (397 amino acids)

>PFLU_RS14725 hybrid sensor histidine kinase/response regulator (Pseudomonas fluorescens SBW25)
MLSTVQAKLLIVDDLPENLLALEALIKREDRQVFKALSADEALSLLLEHEFAMAILDVQM
PGMNGFELAELMRGTEKTKNIPIVFVSAAGRELNYAFKGYESGAVDFLHKPLDIHAVKSK
VNVFVDLYRQSKAMKQQVEALERSRREQELLLTRLQATQAELEQAVRMRDDFMSIVAHEV
RTPLNGLILETQLRKMHLARDNAAAFALDKMHAMVDRDERQIQSLIRLIEDMLDVSRIRT
GKLSIRPARFDLAQLVSNLVENFAPQVAAAESSMQLIVDGPVEGNWDEFRIEQVVTNLLT
NALRYGAKSPVEVRVYSEHGEARVEVRDHGIGISEDNQKRIFQQFERVSASQVAAGLGLG
LFISEQIVAAHGGTIEVESQIGEGALFRVCLPLEQSA