Protein Info for PFLU_RS14670 in Pseudomonas fluorescens SBW25

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13302: Acetyltransf_3
  • amino acids 8 to 142 (135 residues), 55 bits, E=3.8e-18
• PF13420: Acetyltransf_4
  • amino acids 13 to 160 (148 residues), 32.8 bits, E=1.7e-11
• PF13673: Acetyltransf_10
  • amino acids 39 to 145 (107 residues), 41 bits, E=4.5e-14
• PF00583: Acetyltransf_1
  • amino acids 45 to 141 (97 residues), 68.3 bits, E=1.8e-22
• PF13508: Acetyltransf_7
  • amino acids 59 to 143 (85 residues), 49.9 bits, E=8.6e-17

Best Hits

KEGG orthology group: K03825, putative acetyltransferase [EC: 2.3.1.-] (inferred from 100% identity to pfs:PFLU3009)

Predicted SEED Role

"Protein export cytoplasm protein SecA ATPase RNA helicase (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See C3KAA0 at UniProt or InterPro

Protein Sequence (170 amino acids)

>PFLU_RS14670 GNAT family N-acetyltransferase (Pseudomonas fluorescens SBW25)
MHTPEPHIVIQRFTEAHLEGVAALYNEPAVCRQVLQMPFQSVEAWRKRLVMDNERRLQLV
AVHGGEVIGQLGLEQYLRVRQAHVGSFGMGVATAWQGKGVGSRLLTAALDVADNWMNLHR
VELTVYADNEAAQALYRKFGFEVEGVLRDYALRDGRFVDTVSMARLRTSA