Protein Info for PFLU_RS14465 in Pseudomonas fluorescens SBW25

Annotation: ABC-F family ATP-binding cassette domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 PF00005: ABC_tran" amino acids 28 to 176 (149 residues), 61.4 bits, see alignment E=5.5e-20 amino acids 362 to 488 (127 residues), 55.6 bits, see alignment E=3.3e-18

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU2967)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3KB57 at UniProt or InterPro

Protein Sequence (540 amino acids)

>PFLU_RS14465 ABC-F family ATP-binding cassette domain-containing protein (Pseudomonas fluorescens SBW25)
MTDVNRLPALVSLQHLSVQFANGETLLDDLSLSIDHTPTGIVGRNGCGKSVLAHVIAGLL
SPSSGTRNGTATVVYVAQNPVVAPGASIADLTGTTAILSALGRMAQGTAQVDDLELIDDR
WDLAERLRNALDAAGLEALGVDTPADTLSGGQLARIAVIGALLAAPHLLVLDEPTNHLDS
DGRAWLLRQLSEWRGGLVVVSHDRQLLNTMARIVELSPLGVHVYGGNYDAYRHQRNAEQQ
AAVCALEHARLARSRERRRLQKDHDSLQRNAARSRKHAETANVDRFTQARWKGAATEIVH
TLRSAHEQRKHDLDAQVREAYERVMEETPTLLALPASAVPGGRQVVSLIDLELPWLPSSR
LNVQLAGPVRVAVRGPNGCGKSTLLKVLAGAWRAVSGECRVTVPTAYIDQHLALLDDQRS
IVEQLNLLDTPLAEAPLRTRLALLQLDALRVTQPVGQLSGGERLKAAMAIALWREEPAQL
LLLDEPTNHLDLESVTAVEQALQGFTGAIIVVSHDPAFVQTIRPTHYLDWHRTGWSLQCF