Protein Info for PFLU_RS13570 in Pseudomonas fluorescens SBW25

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 304 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF10672: Methyltrans_SAM" amino acids 25 to 302 (278 residues), 452.2 bits, see alignment E=6.6e-140 PF03602: Cons_hypoth95" amino acids 132 to 250 (119 residues), 32.7 bits, see alignment E=6e-12

Best Hits

KEGG orthology group: K06969, ribosomal RNA large subunit methyltransferase I [EC: 2.1.1.-] (inferred from 100% identity to pfs:PFLU2781)

Predicted SEED Role

"Methyltransferase (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See C3K9W0 at UniProt or InterPro

Protein Sequence (304 amino acids)

>PFLU_RS13570 methyltransferase (Pseudomonas fluorescens SBW25)
MNPDALATLHAHLLTALATPPAETRRLFHGRGRCWPGLEQLTVDWLQGVLLVALFKAPEA
AQLQALKQLLQTRFGTYTVALQHRYLPQSTTEWLVGGPVDELTITEGGLRYLIDLGKKQN
SGLFLDMRYGRNWVREQAKGQRVLNLFAYTCGFSVAAIEGGADHVVNLDMARGALSRGRD
NHRLNGHDLSKVSFLGHDLFKSWAKVTHGGPYDLVIIDPPSFQKGSFLLTKDYQRVLRRL
PDLLTPQGTVLACMNDPAFGEDFLIDGVTREAPGLRFVERLQNPPEFPDIDAQSGLKALV
FRQG