Protein Info for PFLU_RS13550 in Pseudomonas fluorescens SBW25

Annotation: crotonase/enoyl-CoA hydratase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 13 to 269 (257 residues), 170.7 bits, E=3.8e-54
• PF16113: ECH_2
  • amino acids 16 to 197 (182 residues), 90.8 bits, E=1.2e-29

Best Hits

Swiss-Prot: 51% identical to DCI1_ARATH: Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal (DCI1) from Arabidopsis thaliana

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 100% identity to pfs:PFLU2777)

MetaCyc: 51% identical to delta3,5-delta2,4-dienoyl-CoA isomerase (Arabidopsis thaliana col)
RXN-12520 [EC: 5.3.3.21]

Predicted SEED Role

"Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (33/35 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (12/14 steps found)
• adipate degradation (5/5 steps found)
• fatty acid β-oxidation I (generic) (6/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• adipate biosynthesis (4/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (4/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
• fatty acid β-oxidation V (unsaturated, odd number, di-isomerase-dependent) (4/5 steps found)
• L-valine degradation I (6/8 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (5/7 steps found)
• methyl ketone biosynthesis (engineered) (4/6 steps found)
• valproate β-oxidation (6/9 steps found)
• oleate β-oxidation (reductase-dependent, yeast) (1/3 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (2/5 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• superpathway of phenylethylamine degradation (6/11 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)
• phenylacetate degradation I (aerobic) (4/9 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (3/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (3/14 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17 or 5.3.3.21

Sequence Analysis Tools

See C3KAY4 at UniProt or InterPro

Protein Sequence (270 amino acids)

>PFLU_RS13550 crotonase/enoyl-CoA hydratase family protein (Pseudomonas fluorescens SBW25)
MSEYQAFVVELAGNVAHVQINRPEKINAMNAAFWTEIIDIFQWVEDTDAVRAVVLSGAGK
HFSSGIDLMMLASVANEFGKDVGRNARLLRRKILELQASFNAVDNCRKPVLAAIQGYCIG
GAIDLISACDMRYAAEGAQFSIKEIDIGMAADVGTLQRLPRIIGDGMLRELAYTGRQFGA
EEARSIGLVNRVYPDQDSLLAGVMEIAHEIAAKSPIAVTGTKAMISYMRDHTVNDGLEYV
ATWNSAMLQSNDLRVAIAAHMSKQKPEFVD